Protein Info for Pf6N2E2_1459 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glycine cleavage system transcriptional activator GcvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF00126: HTH_1" amino acids 8 to 67 (60 residues), 78.8 bits, see alignment E=2.4e-26 PF03466: LysR_substrate" amino acids 93 to 287 (195 residues), 95.3 bits, see alignment E=3.4e-31

Best Hits

Swiss-Prot: 39% identical to GCVA_ECOL6: Glycine cleavage system transcriptional activator (gcvA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 89% identity to pba:PSEBR_a2592)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV83 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Pf6N2E2_1459 Glycine cleavage system transcriptional activator GcvA (Pseudomonas fluorescens FW300-N2E2)
MIANLPPLNAVRAFAAAARHQSFSRAAEELHVSHSAVSRHVKLLEERLGVLLFERRTRQS
LLTPEGKAFYEQVSEALTQIANAATALTRSAAQRKVIINVRPSFAVRWLIPRLPDFVALH
PDIKPEVVTSTRPPDPSREPFDVVIRRGRAGWSAHVQPTALLEDDLLLVAAPSLLQSVPL
ENTHDLARHTLLSGKTRSSDWQAWTVHAGISPLHNPPTLQFDHMHLVLQAAVDGLGVALC
PASLLGKDLSNGRLTCPLPSLRLPLSRYYYGVSRDAAVDAQFFVDWLFSQIRQPATAQPK
A