Protein Info for Pf6N2E2_1455 in Pseudomonas fluorescens FW300-N2E2

Annotation: Xylose ABC transporter, periplasmic xylose-binding protein XylF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 29 to 287 (259 residues), 213.7 bits, see alignment E=3.5e-67 TIGR02634: D-xylose ABC transporter, D-xylose-binding protein" amino acids 29 to 330 (302 residues), 526 bits, see alignment E=1.7e-162 PF00532: Peripla_BP_1" amino acids 51 to 239 (189 residues), 38.5 bits, see alignment E=1e-13

Best Hits

Swiss-Prot: 60% identical to XYLF_ECOLI: D-xylose-binding periplasmic protein (xylF) from Escherichia coli (strain K12)

KEGG orthology group: K10543, D-xylose transport system substrate-binding protein (inferred from 100% identity to pba:PSEBR_a2596)

MetaCyc: 60% identical to xylose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-33-RXN [EC: 7.5.2.10, 7.5.2.13]

Predicted SEED Role

"Xylose ABC transporter, periplasmic xylose-binding protein XylF" in subsystem Xylose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.10 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H355 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Pf6N2E2_1455 Xylose ABC transporter, periplasmic xylose-binding protein XylF (Pseudomonas fluorescens FW300-N2E2)
MKTFKRTLLAGALALLSLPVMADAAHPKIGFSIDDLRLERWSRDRDYFVAAAEKLDAKVF
VQSADANEQKQISQIENLISRGVDVIVIVPFNATVLTNAVAEAKKAGIKVVSYDRLILNA
DIDAYISFDNEKVGEMQASGVLKAAPKGNYFLLGGAPTDNNAKVLREGQMKVLQPAIDKG
DIKIVGQQWVKEWNPTEALSIVENALTRNNNKIDGIVASNDATAGGAIQALAAQKMAGKV
PISGQDADLAAVKRVIDGTQTMTVYKPLKLIASEAAKLSVQLARNEKPTFSSQYDNGSKK
VDTILLTPTPLTKDNIDLLEKDGFYTKAQIAGQ