Protein Info for Pf6N2E2_1435 in Pseudomonas fluorescens FW300-N2E2

Annotation: Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases; sulfonate monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR04021: dimethyl sulfone monooxygenase SfnG" amino acids 6 to 353 (348 residues), 628.9 bits, see alignment E=1.4e-193 PF00296: Bac_luciferase" amino acids 7 to 325 (319 residues), 243.6 bits, see alignment E=1.7e-76

Best Hits

Swiss-Prot: 85% identical to SFNG_PSEPF: FMNH(2)-dependent dimethylsulfone monooxygenase (sfnG) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K04091, alkanesulfonate monooxygenase [EC: 1.14.14.5] (inferred from 100% identity to pba:PSEBR_a2615)

MetaCyc: 85% identical to dimethylsulfone monooxygenase (Pseudomonas fluorescens Pf0-1)
RXN-14709 [EC: 1.14.14.35]

Predicted SEED Role

"Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases; sulfonate monooxygenase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.14.14.5

Use Curated BLAST to search for 1.14.14.35 or 1.14.14.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW63 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Pf6N2E2_1435 Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases; sulfonate monooxygenase (Pseudomonas fluorescens FW300-N2E2)
MSQDTIKFAYWVPNVSGGLVVSKIEQRTDWGIDYNRKLAQIAEAAGFDYALSQVRFTAGY
GAEYQHESVAFSHALLAATTRLKVIAAVLPGPWTPSVLAKQIATIDHLTGGRVAVNIVSG
WFKGEFTAIGEPWLEHDERYRRSEEFITALKGIWTTDNFTLRGDFYRFHDYTLKPKPLQQ
HPEIFQGGSSRAARDMAARVSDWYFTNGNTVEGVKAQIDDLQAKAAANNHKVKVGVNAFV
IARDTEEEARAVLAQIIDQADPEAVNAFGDAAKQAGKSSPEGEGNWAKSSFEDLVQYNDG
FKTNLIGTPQQIAERIVALKAVGVDLVLAGFLHFQEEVEYFGRKVLPLVRELEQRKVAAK
TAAVA