Protein Info for Pf6N2E2_1431 in Pseudomonas fluorescens FW300-N2E2

Annotation: Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 27 to 43 (17 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 330 (280 residues), 114.2 bits, see alignment E=3.1e-37

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 98% identity to pba:PSEBR_a2619)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z188 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Pf6N2E2_1431 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) (Pseudomonas fluorescens FW300-N2E2)
MFYREAGQFNTRYAQDRRVFALRQDRHGLAALLLFAFVVVPWLGNDYWFSAILIPFLVLS
LAGLGLNLLTGYAGQLSLGSAAFMAVGAFATYNLEVRVAGLPLVVSIALGGLTAALVAVL
FGLPSLRIKGFYLLVSTLAAQFFVTWALTRFSWFSNNSASGVISAPRLDVFGINLDAPAG
RYLLTLSVVVALFWLGKNLVRSELGRNWMAVRDMDTAAAVIGIALAKTKLLAFAISGFFL
GVAGALWAFAYLGTVEPHGFDLNRSFQILFIIIIGGLGSLLGNFLGAAFIVLFPVLLSNL
VSLLPGGLVDAGQVENLQKMIFGALIILFLIKEPEGLARLWQRFRQRARLWPLRY