Protein Info for Pf6N2E2_1428 in Pseudomonas fluorescens FW300-N2E2

Annotation: Alkanesulfonates-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00158: Sigma54_activat" amino acids 24 to 187 (164 residues), 238.8 bits, see alignment E=5.4e-75 PF14532: Sigma54_activ_2" amino acids 28 to 192 (165 residues), 56.6 bits, see alignment E=7.3e-19 PF07728: AAA_5" amino acids 45 to 164 (120 residues), 32 bits, see alignment E=2.4e-11 PF25601: AAA_lid_14" amino acids 193 to 270 (78 residues), 77.7 bits, see alignment E=9.6e-26

Best Hits

Swiss-Prot: 78% identical to SFNR_PSEPF: Sigma54-dependent transcriptional regulator SfnR (sfnR) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2622)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV46 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Pf6N2E2_1428 Alkanesulfonates-binding protein (Pseudomonas fluorescens FW300-N2E2)
MQLLTLPPSPGLATSIRATAQVFEDPTSRALLEHLQQVAPSDASVLIIGQTGTGKELVAR
HVHNLSARRHKPFVAVNCGAFSETLVEAELFGHEKGAFTGALTAKAGWFEEADGGTLFLD
EIGDLPLPIQVKLLRVLQEREVVRLGSRKSIKINVRVLAATNVQLEKAINAGHFREDLYY
RLNVVSLVLKPLRERPGDILPLIRHFIAQYSHRLGHGEVTLDAQAQRKLLDYSWPGNIRE
LENVIHHTLLICRNNVIGVQDLHLSNLRIERRDNPPDSAPQSAEALLQKAFEKLLEQEHG
DVYEKVEAELLRTAYRYANCNQVHTASLLGLSRNVTRTLLIRIGELVVNKRRPALSTRDG
QVINLST