Protein Info for Pf6N2E2_1423 in Pseudomonas fluorescens FW300-N2E2

Annotation: Gamma-aminobutyrate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 405 to 427 (23 residues), see Phobius details amino acids 435 to 452 (18 residues), see Phobius details TIGR01773: GABA permease" amino acids 12 to 454 (443 residues), 682.7 bits, see alignment E=1.1e-209 PF00324: AA_permease" amino acids 21 to 432 (412 residues), 406.6 bits, see alignment E=1.4e-125 PF13520: AA_permease_2" amino acids 22 to 439 (418 residues), 129.5 bits, see alignment E=1.7e-41

Best Hits

Swiss-Prot: 68% identical to BAUD_PSEAE: Probable GABA permease (bauD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 99% identity to pba:PSEBR_a2633)

MetaCyc: 60% identical to 4-aminobutanoate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-384; TRANS-RXN-57

Predicted SEED Role

"Gamma-aminobutyrate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVK3 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Pf6N2E2_1423 Gamma-aminobutyrate permease (Pseudomonas fluorescens FW300-N2E2)
MTSPSFKDSNGHLAQGFKPRHVTMLSIAGIIGAGLFVGSGHAIAAAGPAVMLAYLFSGLL
VVLVMRMLGEMAVANPDTGSFSTYADQAIGRWAGFTIGWLYWWFWVLVIPIEALAAGHVL
NQWFPAIDAWLFASVSIVLLAVTNLFSVSKYGEFEFWFAMAKVVAIIGFISLGFAVLMGW
IPEREASGLSRLMEEHGGFAPNGLSAVVGAFITIMFSFIGTEAVTIAAAESDNPAQNIAK
ATRSVIWRIGVFYLLSIFVVISVVPWNDPLLASVGSYQRALELMNIPHAKFLVDMVVLIA
VASCMNSSIYIASRMLYSLGRRGDAPKALKVTSSAGVPRSAVIASTVLGAGVTLFSYFMP
AGLFQFLLASSGAIALLVYLVIAISQLRMRRMLQRQNIELPFRMWLFPWLTWLVIVFISA
ALAVMMVTPEHRSEVSTTLGLALVISFIGLVTSRHSPQPERVVSLG