Protein Info for Pf6N2E2_1419 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type I secretion outer membrane protein, TolC precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 32 to 448 (417 residues), 284.3 bits, see alignment E=8.9e-89 PF02321: OEP" amino acids 36 to 219 (184 residues), 78.6 bits, see alignment E=2.8e-26 amino acids 253 to 430 (178 residues), 109.1 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2636)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTF2 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Pf6N2E2_1419 Type I secretion outer membrane protein, TolC precursor (Pseudomonas fluorescens FW300-N2E2)
MVDRRRYRCRVLLGLYTGWALIDPLWAAEGGLSLTAAYDASRLNDPTVQSAAHAFEASRH
EEDIGRGGLYPQVSLTSRYGYGGRTDGGDDSTYVNSNDYQANNVTLAAQQPLYDKARWAA
YQEGKARGQLGTQVFDVAGQTLYDRVAKGYFDVARAENEIKLIQQQKAAIQGLVVQSKKL
YEGGQGAITDIDEAQARLDLVQAQEAEAQARRVAALRALSGRASVPIDDILPMREELAAG
SPIPPEQDLPYWTAIAREASPELAARLAAVKVAEAQADSQRAGHYPTLSLTTQLTRRETR
QYQELDPRQDTYYVGVQLDIPLYRGGAVRASVAKAEAQLAGAQSDYDVQRQQLAEDIEAD
YLGVVAGFAKSKAMQRAVESNQRALTSTEKGFQGGVRSTVDILDAQQRLFQARRDLLNTK
LDMLQSYVSLHTHTGQMNRAVLEQVQSLF