Protein Info for Pf6N2E2_1408 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nitrous oxide reductase maturation protein NosR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 716 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 418 to 436 (19 residues), see Phobius details amino acids 453 to 478 (26 residues), see Phobius details amino acids 495 to 520 (26 residues), see Phobius details amino acids 553 to 573 (21 residues), see Phobius details amino acids 593 to 610 (18 residues), see Phobius details PF04205: FMN_bind" amino acids 82 to 168 (87 residues), 30.4 bits, see alignment E=5.3e-11 PF12801: Fer4_5" amino acids 493 to 539 (47 residues), 56.1 bits, see alignment 2.8e-19 amino acids 595 to 637 (43 residues), 24.8 bits, see alignment 1.7e-09

Best Hits

Swiss-Prot: 71% identical to NOSR_PSEAE: Regulatory protein NosR (nosR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a2643)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosR" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZVA2 at UniProt or InterPro

Protein Sequence (716 amino acids)

>Pf6N2E2_1408 Nitrous oxide reductase maturation protein NosR (Pseudomonas fluorescens FW300-N2E2)
MLHLSRLWLRGLFVFLLLFTGLAQAKDYGDTPQQRIHHVLGQTDAISEPEGRFKVRTLSA
AGKVLGYVFQSLDVVDIPAYSGKPINVQVILDPAGVILDAYVLEHHEPILLIGIAEEKLH
AFSARYSGIKVNQRVVVGHSSDPNAVTVDAIAGATVTAMVVNEVIMRAAHDVAVSLGLVK
GDAGLAVAPARVREDIYEPADWKTLTGNGAVRRLHLTRGQVDATFKGTDAEQVEVASAAQ
ADDTFIDLYVTHLNPPTIGRNLLGDGQYRTLMSELKPGEQAIAVMGSGRYSFKGSGYVRG
GIFDRVLVRQFGDVISFRDMDFQRLDDVAAEDMPEFDEMAVFIVRASHRFDPGSPWSLEL
LIRRQTGPVSGIFSSFELAYQLPEPYLERPLPTAEQLAAAEEASRPMWLTLWYQKSVEIT
VLGVALLVLTAILFFQDSLARRPTLLHWLRRGYLVFTVVFLGGYALAQLSVVNVLTFVHA
LFEGFRWELFLTDPLIFILWVFTAGSILLWGRGVFCGWLCPFGALQELINELARKLKVPQ
YELPFAVHERLWAIKYIILLVLFGVSLESMATAERLAEVEPFKTAITLRFDRQWWFVAYA
VGLLVINLFTRKVYCRYVCPLGAALAMPTRLRLFDWLKRRKECGNPCQLCAKECEIQAIH
PDGRINANECHYCLDCQMTWHNENKCPPLINKRKKRGKAAVSDPQLIPVVQVNPAP