Protein Info for Pf6N2E2_1406 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nitrous oxide reductase maturation protein NosD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR04247: nitrous oxide reductase family maturation protein NosD" amino acids 39 to 421 (383 residues), 459.2 bits, see alignment E=8.1e-142 PF05048: NosD" amino acids 145 to 357 (213 residues), 192.7 bits, see alignment E=5.9e-61 PF13229: Beta_helix" amino acids 161 to 326 (166 residues), 63.5 bits, see alignment E=1.8e-21 TIGR03804: parallel beta-helix repeat" amino acids 162 to 201 (40 residues), 29.4 bits, see alignment 5e-11

Best Hits

Swiss-Prot: 74% identical to NOSD_PSEST: Probable ABC transporter binding protein NosD (nosD) from Pseudomonas stutzeri

KEGG orthology group: K07218, nitrous oxidase accessory protein (inferred from 95% identity to pba:PSEBR_a2645)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosD" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVJ7 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Pf6N2E2_1406 Nitrous oxide reductase maturation protein NosD (Pseudomonas fluorescens FW300-N2E2)
MTGNMQHPNVRRLVIALVFSLLSGGVLGAPQPITDLPLQAEGDQQWRLPAGQYRGSFSID
QPMTLTCAPDAVFQGQGEGNGVIIRAPNVRVQGCTFLDWGHDLTAMNAAVFIQPVAQGAV
VRGNRMQGQGFGIWVDGTRDVSLIDNRIQGDPSLRSQDRGNGIHLYAVHGARVIGNQVRE
TRDGIYIDTSSGNLLQGNVLEDLRYGVHYMFANDNRLLDNVTRRTRTGYALMQSRQLTVI
GNRSEQDQNYGILMNYITYSTLRDNFVTDVRDGSTGDTMITGAEGKALFIYNSLFNRIEG
NHFERSAVGIHLTAGSEDNRIAGNAFVHNQRQVKYVATRLQEWSVDGHGNYWSDYLGWDR
NGDGLGDVAYEPNDNVDRLLWLYPQVRLLMNSPGIELLRWVQRAFPVMKSPGVMDSHPLM
ETPVQPPPRNSAQEDAS