Protein Info for Pf6N2E2_1404 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nitrous oxide reductase maturation transmembrane protein NosY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 101 to 102 (2 residues), see Phobius details amino acids 105 to 131 (27 residues), see Phobius details amino acids 138 to 164 (27 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 221 to 229 (9 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 5 to 274 (270 residues), 156.2 bits, see alignment E=1.1e-49 PF12730: ABC2_membrane_4" amino acids 21 to 185 (165 residues), 36.6 bits, see alignment E=4.7e-13

Best Hits

Swiss-Prot: 80% identical to NOSY_PSEST: Probable ABC transporter permease protein NosY (nosY) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a2647)

Predicted SEED Role

"Nitrous oxide reductase maturation transmembrane protein NosY" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z130 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Pf6N2E2_1404 Nitrous oxide reductase maturation transmembrane protein NosY (Pseudomonas fluorescens FW300-N2E2)
MNPVWNMARKEFSDGLRNRWLLAISLLFAVLAIGIAWLGAAASGQLGFTSVPATVASLSS
LATFLMPLIALLLAYDAIVGEDESGTLLLLLTYPLGRGQLLLGKFVGHGLILALATFIGF
GCAMLAIALWVDDVQLSLLLWAFGRFMVSSTLLGWVFLGLAYVLSSLSAEKSTAAGLALG
VWFFFVLVFDLALLALLVLSEGRFSPELLPWLLLFNPTDVYRLINLSGFDAASSGAAVLT
LGSDLPVSAPLLWLCLGLWMAVPLWLAYRLFNRRCP