Protein Info for Pf6N2E2_1398 in Pseudomonas fluorescens FW300-N2E2

Annotation: Rhodanese-related sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03865: PQQ-dependent catabolism-associated CXXCW motif protein" amino acids 13 to 173 (161 residues), 228 bits, see alignment E=3e-72 PF00581: Rhodanese" amino acids 51 to 164 (114 residues), 33.7 bits, see alignment E=2.1e-12

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2652)

Predicted SEED Role

"Rhodanese-related sulfurtransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z119 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Pf6N2E2_1398 Rhodanese-related sulfurtransferase (Pseudomonas fluorescens FW300-N2E2)
MPRLLAILLLGLALNVAQADTALFSAQGYRIAQYRSPTPATVDGAQTLDTQALQQLLEQA
SPPVLIDVYRRAWVQGRFIDNEPHANLPGSLWLANTGDGDLDPTWQDYFSHHLRTATGGR
LDSPLVFYCRADCWLSWNAVKRAAAMGYNHVYWYRDGLDAWEAANLPLQAARPEPFP