Protein Info for Pf6N2E2_1396 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR03864: ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system" amino acids 3 to 237 (235 residues), 342.5 bits, see alignment E=5.7e-107 PF00005: ABC_tran" amino acids 19 to 162 (144 residues), 111.9 bits, see alignment E=3.8e-36

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2654)

MetaCyc: 32% identical to lipopolysaccharide transport system ATP-binding protein LptB (Helicobacter pylori 26695)
RXN-23614 [EC: 7.5.2.5]

Predicted SEED Role

"ABC transporter, ATP-binding protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW35 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Pf6N2E2_1396 ABC transporter, ATP-binding protein (Pseudomonas fluorescens FW300-N2E2)
MNALEVSDLSFAYGAREALKQMNFSLPAGRFAALLGPNGAGKSTLIALLTRLYDLQRGEI
HIGGHSLQKSPRPALRQLGVVFQQSTLDLDLSIEQNLRYHLALHGFSRRQGSARIDAELT
RQHLTERRHERVRDLNGGHRRRVEIARALLHEPHLLLLDEPSVGLDPASRLALALHIRQL
CSEQGISVLWTTHLLDEVQPSDDLLIVHQGRLVASGQADAVSLEHGGTLGSAFTRLTATG
VGP