Protein Info for Pf6N2E2_1395 in Pseudomonas fluorescens FW300-N2E2

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR03866: PQQ-dependent catabolism-associated beta-propeller protein" amino acids 21 to 329 (309 residues), 546 bits, see alignment E=2.2e-168 PF21783: YNCE" amino acids 33 to 105 (73 residues), 31.3 bits, see alignment E=2.8e-11 PF02239: Cytochrom_D1" amino acids 77 to 173 (97 residues), 28.2 bits, see alignment E=1.5e-10 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 111 to 152 (42 residues), 36.4 bits, see alignment 4e-13 amino acids 287 to 328 (42 residues), 49.6 bits, see alignment 2.9e-17

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUZ7 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Pf6N2E2_1395 Uncharacterized conserved protein (Pseudomonas fluorescens FW300-N2E2)
MRRPLFKPALLCQVLALGAVLLAAGPAAASIAWVSNEKDNSLSLIDMQSLEVIETLPVGQ
RPRGLLLSHDNRLLYICASDSDRVQVMDVATRKIIKELPSGKDPEQFALHPNDRWLYVSN
EDDALVTVIDTQTSEVLGQIGVGVEPEGMAVSPDGKWAVNTSETTNMLHWIDTSTQTLAD
NTLVDQRPRFVEFNRDGTQLWASAEIGGTLTVLDVATRQVLKTLTFQIKGVHPDKVQPVG
IKLSADGKLAFVALGPANHVAVIDAKTFEVLDYLLVGRRVWQLAFTPDQKQLLATNGVSG
DVSVIDVESRKVLKSVKVGRYPWGVVVTP