Protein Info for Pf6N2E2_1378 in Pseudomonas fluorescens FW300-N2E2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 22 to 251 (230 residues), 64.3 bits, see alignment E=6.2e-22

Best Hits

KEGG orthology group: None (inferred from 68% identity to bmj:BMULJ_03330)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTC8 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Pf6N2E2_1378 hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MTSPSGVIVPLFAISAAKTHVRMLAIDALRGFVMLLMLVDHVRETFLLHRQVTDPIDALS
VTPDLYFTRLLSTLCAPVFIFLTGLSAWLYSQKHTAGQTSLFLLKRGLFLVFLELTFVCF
AWNAEFPPKTLWLQVIWCIGICMIVLAALLHLKRRWLILLGVAIVAGHNLLDGVVPGPDS
PFFVPWSILHQRAFIDITEFTRARTTYPVLPWIGVILLGWAIGPWFGKDVEPAVRLRRLF
KMGLGLLLAFVLIRYLNVYGDKPWLQTGDALRTFMSFMSATKYPPSLMFLMPTLGIGLML
LALFEKAQDRGAIALLAIYGGAPMFFYLLHLYVLKALYLTAVAIWGTNQGTYFGFDDLPM
VWLWSVLLGVVLFFPTRWFAGLKQRRRDIAILKYL