Protein Info for Pf6N2E2_1375 in Pseudomonas fluorescens FW300-N2E2

Annotation: Multiple polyol-specific dehydrogenase (EC 1.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00106: adh_short" amino acids 7 to 190 (184 residues), 185.2 bits, see alignment E=1.9e-58 PF01370: Epimerase" amino acids 9 to 140 (132 residues), 23.4 bits, see alignment E=7.4e-09 PF08659: KR" amino acids 9 to 163 (155 residues), 33.7 bits, see alignment E=7.1e-12 PF13561: adh_short_C2" amino acids 13 to 253 (241 residues), 185.4 bits, see alignment E=2.7e-58

Best Hits

Swiss-Prot: 76% identical to SDH_RHOSH: Sorbitol dehydrogenase (polS) from Rhodobacter sphaeroides

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2675)

MetaCyc: 62% identical to galactitol 2-dehydrogenase (Agrobacterium fabrum C58)
Galactitol 2-dehydrogenase. [EC: 1.1.1.16]

Predicted SEED Role

"Multiple polyol-specific dehydrogenase (EC 1.1.1.-)" in subsystem Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z0U8 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Pf6N2E2_1375 Multiple polyol-specific dehydrogenase (EC 1.1.1.-) (Pseudomonas fluorescens FW300-N2E2)
MKRLEGKSALVTGAARGIGRTFAQAYINEGATVAIADIDLERAQATAAELGDSAYAVKMD
VTDQASIDQAIEAVVARVGKLDILINNAALFDLAPIVEITRQSYERLFSINVAGTLFTLQ
AAARQMIRQGHGGRIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLDLIKHRINVNA
IAPGVVDGEHWDGVDALFARHENLPLGEKKRQAGQQVPYGRMGTAEDLTGMAIFLASTES
EYVVAQTYNVDGGNWMS