Protein Info for Pf6N2E2_1315 in Pseudomonas fluorescens FW300-N2E2

Annotation: 5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR02337: homoprotocatechuate degradation operon regulator, HpaR" amino acids 7 to 135 (129 residues), 176 bits, see alignment E=1.4e-56 PF12802: MarR_2" amino acids 30 to 89 (60 residues), 38 bits, see alignment E=1.5e-13 PF01047: MarR" amino acids 32 to 90 (59 residues), 50.2 bits, see alignment E=1.9e-17

Best Hits

Swiss-Prot: 44% identical to HPCR_ECOLX: Homoprotocatechuate degradative operon repressor (hpcR) from Escherichia coli

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a2736)

Predicted SEED Role

"5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation (EC 4.1.1.68)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.68

Use Curated BLAST to search for 4.1.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z0F8 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Pf6N2E2_1315 5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68) (Pseudomonas fluorescens FW300-N2E2)
MPKLRQSLTLTLLQAREAAMGFFRPSLNQHGLTEQQWRVIRILSQHDELEINRLAELACI
LKPSMTGVLVRMEAAGMVVRRKAEQDQRRVLVRLAPQGQASFDSMSQSMEANYQRLQDKL
GEEKLQTLLGLLNDLKAIRR