Protein Info for Pf6N2E2_1298 in Pseudomonas fluorescens FW300-N2E2

Annotation: Xanthine transporter,putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 225 to 253 (29 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 249 (221 residues), 48.9 bits, see alignment E=2.3e-17 amino acids 234 to 402 (169 residues), 57.3 bits, see alignment E=6.5e-20

Best Hits

Swiss-Prot: 44% identical to YFCJ_SHIFL: Uncharacterized MFS-type transporter YfcJ (yfcJ) from Shigella flexneri

KEGG orthology group: None (inferred from 86% identity to pba:PSEBR_a2758)

Predicted SEED Role

"Xanthine transporter,putative" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZV99 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Pf6N2E2_1298 Xanthine transporter,putative (Pseudomonas fluorescens FW300-N2E2)
MTQDNIHLGASSAPKAAVEANPALKLSPLTLTVFIGFLTIGMQLPVLPLHLHDALGMGTL
VIGLVVGAQFAAALLSRAWAGNFADMRGGKRAVMTGLVTAAVSGLVYLLSLAFVAAPVTS
VWLLSGGRVLLAIGESLIVTGALGWGIGLVGAQHAGKVMAWNGIAMYGAYALGAPLGVAL
NGGWGFTGIAMASMFIPLLAMAIVAGVRAVAPTATRRTPFYTMLGAVWVPGMGLAFCSVG
FGVVTAFIALLFAARDWGNASLAFTAFGVAFIAARLLFGHLPDKIGGARVALVCVLIETV
GLLLIWSADTATMAYLGAAFTGFGYSLAFPGFGVEAVRRAPPQARGLAMGAYVAFLDISL
GITSPLAGLLASGWGIGAVYLGGAIAVGLSFGVALMLLRGRHAQVQYKF