Protein Info for Pf6N2E2_1277 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 6 to 140 (135 residues), 53.5 bits, E=1.1e-17
• PF13420: Acetyltransf_4
  • amino acids 17 to 158 (142 residues), 39 bits, E=2.1e-13
• PF00583: Acetyltransf_1
  • amino acids 36 to 139 (104 residues), 65.2 bits, E=1.7e-21
• PF13673: Acetyltransf_10
  • amino acids 39 to 143 (105 residues), 31.8 bits, E=3.1e-11
• PF13508: Acetyltransf_7
  • amino acids 57 to 140 (84 residues), 49.1 bits, E=1.5e-16

Best Hits

Swiss-Prot: 38% identical to AAAT_ECOLI: L-amino acid N-acetyltransferase AaaT (aaaT) from Escherichia coli (strain K12)

KEGG orthology group: K03825, putative acetyltransferase [EC: 2.3.1.-] (inferred from 99% identity to pba:PSEBR_a2796)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A0A159ZVT3 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Pf6N2E2_1277 Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1) (Pseudomonas fluorescens FW300-N2E2)
MSESSITLVRFTETHIAGVTALYNDPAVTRQVLQMPFQSTEVWRKRLAMDDERLLKLVAL
HEGEVIGNLGLEQFSRVRRAHCGSLGMGVAVAWQGKGVGSMLLAAALDVADNWMNLRRVE
LTVYADNEAAIGLYRKFGFETEGLMRDYAVRDGRWVDTLAMARLR