Protein Info for Pf6N2E2_127 in Pseudomonas fluorescens FW300-N2E2

Annotation: AttE component of AttEFGH ABC transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00005: ABC_tran" amino acids 21 to 166 (146 residues), 113.3 bits, see alignment E=7e-37

Best Hits

Swiss-Prot: 42% identical to YBBA_ECOLI: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Escherichia coli (strain K12)

KEGG orthology group: K02003, (no description) (inferred from 96% identity to pba:PSEBR_a3745)

Predicted SEED Role

"AttE component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YJW7 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Pf6N2E2_127 AttE component of AttEFGH ABC transport system (Pseudomonas fluorescens FW300-N2E2)
MLEVRQVHKSYPTPQGPLPVLQGIDLTLMPGSSLALMGESGSGKSTLLHLVAGLDKVDRG
SIRSGEHRLDGMSESQLANWRRTEIGLVFQQFNLISSLSVEDNLAFQARLCGRHDAAWQA
HLVQRLGLSGLLRRYPEQLSGGQQQRVALGRALASRPPLLLADEPTGSLDEATSDEVLQL
LLELLEGSPTSLLMVTHSPRVAARLAQRVVLHGGRLAQVTQG