Protein Info for Pf6N2E2_1268 in Pseudomonas fluorescens FW300-N2E2

Annotation: NADH pyrophosphatase (EC 3.6.1.22)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF09296: NUDIX-like" amino acids 17 to 105 (89 residues), 45.6 bits, see alignment E=1.6e-15 PF09297: Zn_ribbon_NUD" amino acids 107 to 138 (32 residues), 35.7 bits, see alignment 8.2e-13 PF00293: NUDIX" amino acids 144 to 256 (113 residues), 83.5 bits, see alignment E=2.1e-27

Best Hits

Swiss-Prot: 89% identical to NUDC_PSEPF: NADH pyrophosphatase (nudC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03426, NAD+ diphosphatase [EC: 3.6.1.22] (inferred from 99% identity to pba:PSEBR_a2805)

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZX33 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Pf6N2E2_1268 NADH pyrophosphatase (EC 3.6.1.22) (Pseudomonas fluorescens FW300-N2E2)
MISRWTTAVLDTALAGGWAVARSPEGFLFDDNGALFPREWLKRQDLSVLAEHGIGHLDGE
PVYLLELHSSLDIPGCNWKGLRAFMLEDDHTLYKVLGYAAQIGTWAREHRFCGSCGKRMG
QIPLERAMYCDACELRHYPRISPSMIVLITRGDEVLLARSPRFVPGVYSTLAGFAEPGES
AEDCLVREVREEVSIEVKNIQYMGSQCWPFPHSMMLGFHAEYAGGDIVPQEDEIEDAQWF
NVHDLPPLPASRSIARYLIDLYVARRLGHAEPVLPG