Protein Info for Pf6N2E2_126 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG00960892: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details PF00884: Sulfatase" amino acids 271 to 506 (236 residues), 54.3 bits, see alignment E=6.6e-19

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a3746)

Predicted SEED Role

"FIG00960892: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YJW3 at UniProt or InterPro

Protein Sequence (565 amino acids)

>Pf6N2E2_126 FIG00960892: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MARYLKELLLVLYLLKGYDYYLDRLSALGLGFATLLFGAMFTVLVLALWMSAYIRQTLVR
HVFALAMFVSAVFFEVYTRVTDSYLTYSQFVSLVYSGGFIQEAAYQYRDVIISAVISGLL
LLFGIALKPRRSVRLPGYLPIAAPVLGMLLLSGVLFVRAGEGARGLPVMYTPLAYLNLFA
YESLHSTIGPREPVTLVRRSSLIEQDIVLIIDESIGGNYLDINAPFGVHTGLKTPPEGVD
IFNFGYAASIANCSADTNVTLRYGGTRADYIRINSTRPSIWQYAKKAGLRTVYIDAQRTG
GYLQNLMTELEKQDIDEFVQFDQASVRDRDMAAAAKLIELLGDNQAELVVINKVGAHFPV
HDKYPDDFMNYRPALPRGQFQEVADTASRDGFNGQKDDWLLYRNAYQNTLLWNVGEFFKR
IFQQADLSHAVLIYTSDHGQDLHERGNPGLNTHCGGDPVAEEGLVPLVVIQGSQLHTLDW
RDAWARNKDRSSHYNIFPTLLQLMGYDPAGVESAYGKSLSQPTDDDFTFNYRFNARLGAK
PAWKHIDLGDIVTPQSGQVEMAVGH