Protein Info for Pf6N2E2_1241 in Pseudomonas fluorescens FW300-N2E2

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details PF19443: DAHL" amino acids 35 to 261 (227 residues), 93 bits, see alignment E=2.4e-30 PF02518: HATPase_c" amino acids 483 to 594 (112 residues), 63.5 bits, see alignment E=2.4e-21

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2815)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUM1 at UniProt or InterPro

Protein Sequence (598 amino acids)

>Pf6N2E2_1241 sensor histidine kinase (Pseudomonas fluorescens FW300-N2E2)
VTTIIKKYKWPALLAIALVVFSALIFFLIKSYTYDSSTYFESRDFIRQLKQADANWNVKI
LRKKIGMNNNLSLTPPLEAGSRWEQLEQLNNAGPLAVLWASRRNGYVEAVKNKTVLVDQF
QQHNANLRTALDALPMVEDGIQTLLDGMSAESPTEHLATASNVRELTLTTLEYALYVTSD
KAEEVQRQLSDLEKYLDQLPATSQPLFIALTQHVKSIIQEQPIVNDLLDRISVIPVAQEL
DSITELLNETQRRTAAADRQYHIYLGACASLMALLMIYLAVRLVRSYAVINQINQQLQTS
NERLEERVQERTRELMEAERELVDAARMAGMAEIATNVLHNVGNVLNSVNISAELVTRKL
RNSKTIGLTKAVKMMNEHAEDLGQFITHDEKGRLLPRYFNELVDSIAAEQAVLIDELAQL
TKSIDHIKEIVTTQQTYAGAARLIEPLNVSDLFEDALRMNSGALSRHHVTVIKEYQDVPA
IMGDKHRLLLILINLISNAKFAMSHTSEHPREMTLGIRILDETTLCLSVKDRGEGISPEN
LARIFNHGFTTRKDGHGFGLHSCALAAVEMNGRLYVHSDGPGQGALFTLEVPLELARA