Protein Info for Pf6N2E2_1226 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): DNA damage response nuclease
Rationale: Conserved and specific phenotype: important for resisting cisplatin. Contains a VRR-NUC domain that is predicted to have nuclease activity.
Original annotation: Hypothetical protein, restriction endonuclease-like VRR-NUC domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 387 to 392 (6 residues), see Phobius details PF21315: FAN1_HTH" amino acids 10 to 91 (82 residues), 124.5 bits, see alignment E=1.9e-40 PF18081: FANC_SAP" amino acids 100 to 145 (46 residues), 44.9 bits, see alignment 1.7e-15 PF08774: VRR_NUC" amino acids 433 to 545 (113 residues), 128.2 bits, see alignment E=2.4e-41

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2829)

Predicted SEED Role

"Hypothetical protein, restriction endonuclease-like VRR-NUC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZSZ5 at UniProt or InterPro

Protein Sequence (556 amino acids)

>Pf6N2E2_1226 DNA damage response nuclease (Pseudomonas fluorescens FW300-N2E2)
VAVRSLDDPFYYLNNFQQVLAWLTQRYADVLSTDEQRFIEHFAALPRGAQGLLVRMVMRK
GLRFRHSKLHYPEIGDISAAVAPLLALGWVEEQAPIGLVELFEVLLKPEILLCLGHLIEH
PKAKKTEWLHALDEHLNQPQPFDAWCPQLDDRLYSLTIMSLCDRLRLMFFGNLYQDWSEF
VLADLGIFTYETVEFSAESRGLRSREDVDACLFLHDCQQRFEAGEPPEEIVAQVNELSLD
NPWLERRRGKLLFQIGQHGERIGDFALALGIYRDCTYPGARLRMVRVLERIGEYGLALEL
GEVAMQAPQSAAETQALLRIVPRLRRKLGGPPVPRGLAREVERLELQLPRVDPTLSVEYH
VQAHLHDDTAPVHYVENSLINSLFGLLCWPAIFAPLPGAFFHPFQRGPADLLNEDFHARR
AELFAACLVELDDGRYRQTISRRYAEKWGVQSPFVFWGALSEPLLEQALDCLPAAHLKHW
FDRLLLDIKANRAGMPDLIQFWPQHKTYRMIEVKGPGDRLQDNQLRWLEFCHEHQMPVAV
CYVQWAESAIASDGAA