Protein Info for Pf6N2E2_1221 in Pseudomonas fluorescens FW300-N2E2

Annotation: sodium/hydrogen exchanger family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 232 to 260 (29 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details amino acids 413 to 438 (26 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 11 to 270 (260 residues), 85.3 bits, see alignment E=2e-28 amino acids 333 to 437 (105 residues), 30.6 bits, see alignment E=8.1e-12

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2834)

Predicted SEED Role

"sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWZ3 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Pf6N2E2_1221 sodium/hydrogen exchanger family protein (Pseudomonas fluorescens FW300-N2E2)
MTFTVWVAVLGAVLLTLALTSSYLRWMPVTTSAMCLVLGVAIGPIGLDVLKLDISDSAVW
MEHLTEVAVVFSLFVSGLKLRLPLKNRTWRVAYGLAGPVMILCIAGLCLALHYLLGLGWG
VSMLIGAMLAPTDPVLAALVQVNDARDDDRVRFGLSGEAGLNDGTAFPFVILGLLMLRED
GSGFLGEWLLRNVLWAVPAGLLVGYWMGRGIGKLTLSMRIRNADSTLSPNDYLALALIAL
AYVVAEWIQGYGFLSVFAAGLGLRQAEVKSTDEAAPPAEHLVQPVVGHETVDPQQAVLGD
TESLDDGQLAAGVMMSDMLAFGSLVERSMEVFLVTLLGVVLANHWDWRALAIGALLFAVI
RPLSVLALPWGRLLDGPQRLLIGWFGIRGIGSLFYLFFALNNDLQPEVEQLCINLTLSVV
ALSILVHGVTTQPTLAWYERRKHPR