Protein Info for Pf6N2E2_1217 in Pseudomonas fluorescens FW300-N2E2

Annotation: Gll2069 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR02050: carboxylate-amine ligase, YbdK family" amino acids 3 to 287 (285 residues), 309.8 bits, see alignment E=9.3e-97 PF04107: GCS2" amino acids 3 to 341 (339 residues), 251.4 bits, see alignment E=9e-79

Best Hits

Swiss-Prot: 52% identical to GCS2_PSEF5: Putative glutamate--cysteine ligase 2 (PFL_4726) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K06048, carboxylate-amine ligase [EC: 6.3.-.-] (inferred from 96% identity to pba:PSEBR_a2837)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUJ9 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Pf6N2E2_1217 Gll2069 protein (Pseudomonas fluorescens FW300-N2E2)
MKFGIEEEYFITDLQTRCMPGEPPAQAIAACQAELGKHFAHEMFLCQVEMASPIFRSLSE
AADYLSQVRTDLNQRLAPYGLGLLSAGSHPMTTQVLQPTDELHFQQLFDDYQRVARRSVL
SGLHIHVEVPAIQDRVRVMNEILPWLPMFLALSASSPFWNGGYSGFSSYRQVACDEWPRM
GVPEFFEDESAFASYVDMLMRTGSIRQPSDCWWVIRPSSRYPTLELRICDACPRVDDVLC
LASLFRLMVAHAVAQRRPGANYSQMSQWVLKENRWRAKRHGILAEFIVEGQEQPMLIGEW
LTLAEQTFGETAAELGVQDVFGQVRRIVQEGTSADRQIVLFEQGLLLGDSVEQALGRVVD
QLLAETVGLPVADPALQQVAGGP