Protein Info for Pf6N2E2_1184 in Pseudomonas fluorescens FW300-N2E2

Annotation: L-Proline/Glycine betaine transporter ProP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 234 to 258 (25 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 365 to 388 (24 residues), see Phobius details amino acids 394 to 415 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 12 to 406 (395 residues), 82.3 bits, see alignment E=3.5e-27 PF07690: MFS_1" amino acids 20 to 286 (267 residues), 59.3 bits, see alignment E=3.3e-20 amino acids 288 to 418 (131 residues), 34.3 bits, see alignment E=1.3e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2871)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV27 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Pf6N2E2_1184 L-Proline/Glycine betaine transporter ProP (Pseudomonas fluorescens FW300-N2E2)
LDSQGRERRKLVLAVSVGAALEWFDFTLFAIFSLQIAAAFFPASDPLMSLLASYLALAVG
FVARPLGALLMGRYADRQGRKAALTLSIMLMGAGTLIIAVCPTYETIGWWAPLSVVVARI
LQGVAAGGEIGGALAYLVETAPADRRALFASSQQVAQAGSFLLCGLSASLLSSALTPAQL
DEWGWRVPYVFGLLVVVAGLKIRRSLEESEPLRRFLDNQDKHAMAGKGPSLRPYLPNLVM
GVLIVVLWTVATQLINFIPTYASMVLELPRNKAYLGLVLVGLITLLCPLTALLSDRIGRY
TVMLIGAVGVALCAYPGFVWLNNSPSLQTLIIFQCALAVLMVLYTGPAAAALAELFPVQV
RALGVSLAYALSVTLFGSATPALITLIYRQSGDALAAAHWLFAAACLSAIPLAWVSLSKY
RASATPALTAEHET