Protein Info for Pf6N2E2_1183 in Pseudomonas fluorescens FW300-N2E2

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 217 to 243 (27 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 356 (328 residues), 134.3 bits, see alignment E=2.6e-43

Best Hits

KEGG orthology group: None (inferred from 92% identity to pba:PSEBR_a2872)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWR6 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Pf6N2E2_1183 Major facilitator family transporter (Pseudomonas fluorescens FW300-N2E2)
MTIANTHIDADAEVVPDTAPLPIGSLFALALAAFVTILTEALPAGLLSQISEGLAISEAL
AGQLVTVYAIGSLLAAIPLTAATQGMRRRSLLLMAIAGFAVANTVTTFSTHYGLTIVARL
LGGVSAGLLWALLAGYAARMVPESQKGRAIAIAMVGAPLALSLGVPAGTLLGNLVGWRMS
FALMSLFAVALMVWVRLKVPDFPGQASSKRLALGQVFTLPGVRSVLFVVLAFVLAHNILF
TYIAPFLTAAGLGERTDLVLLVFGVASLLGIWVVGVLIDRHLRALTLAGTVLFALSAMML
GAMNDRPAAVYIAVAAWGIAFGGAGTLFQTAIAKTAGDAADLAQSMLVTAWNLAIAGGGI
VGGILLDHLGVVAFAPVLVVLLLLTLAVVGSARQYGFAKRVQ