Protein Info for Pf6N2E2_1133 in Pseudomonas fluorescens FW300-N2E2

Annotation: TonB-dependent ferric achromobactin receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 807 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF07660: STN" amino acids 68 to 118 (51 residues), 29.8 bits, see alignment 6.3e-11 PF07715: Plug" amino acids 164 to 256 (93 residues), 64.9 bits, see alignment E=1.3e-21 TIGR01783: TonB-dependent siderophore receptor" amino acids 165 to 807 (643 residues), 355.2 bits, see alignment E=4.2e-110 PF00593: TonB_dep_Rec" amino acids 366 to 772 (407 residues), 143.1 bits, see alignment E=3.8e-45

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 97% identity to pba:PSEBR_a2949)

Predicted SEED Role

"TonB-dependent ferric achromobactin receptor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUD1 at UniProt or InterPro

Protein Sequence (807 amino acids)

>Pf6N2E2_1133 TonB-dependent ferric achromobactin receptor protein (Pseudomonas fluorescens FW300-N2E2)
MSAVAPLLLRPAFAGWRPLLNLSLMLSLSTSPFFISSSLAEDADRRSYQVPAGSLGVALT
RFAGLAGVNLSVDPALVGGRNSAGLSGEFGVEEGFARLLSGSGLQLQAVGEQAYILAPAP
ERGSLQLAPTSILGATASTDSPAYAGGQVARRGSQGLLGSRDFMETPFSMTTYTSAVVKN
QQARTLGDLIASDPSVRATNPAGGRYEQFTIRGFSLFNSDVAYNGLYGILPTYTIDMEMA
ERVDILKGPSQLINGISPRGSVGGGINVVPKRATDKPITSFTGSYASNNQLGGAVDVGRR
FGEDDKFGIRFNGVKQAGDTEWDHQSVDREMAVLGLDFRGERLRLSTDIGHTERNTDAPQ
ERVQVGANAQVPHASDVRDNYAQSWSKARTKDTFGAVNAEFDVNDSVMLYGGVGARKSEH
DFLRHNVSVTNDAGDFTVQPRDFTRDENVRTATAGVRNWFHTGPVSHEVNLAASYFYMDF
ENGGARYANGRSNLYDPVQTPTPSNPTRQDDKVYTENRFSGVALSDTLGLLDDRLLLTLG
ARWQRVKVDDWTNNVKGDTAYDEEKVSPSGGILFKATDKLSLYANYMEGLSQGKIAPSTS
VNEDEIFPPFISRQVEVGAKYDAGPFAVTAALFRIKQPAYATDATTRVFGPNGKRENTGV
ELSVFGEPLKGTRLLGGVMYIDSELTHTTNGTFDGNRAPATPKYNVNLGAEWDVPTLQGL
TLTSRGIYSSSQYLDQSNTKEIDSWERFDVGARYAFKVDEKHITLRANIENVADKRYWSS
AGASDDSEPGLTLSTPRTYLLSATVDF