Protein Info for Pf6N2E2_1128 in Pseudomonas fluorescens FW300-N2E2
Annotation: Two-component response regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 35% identical to NARL_ECOL6: Nitrate/nitrite response regulator protein NarL (narL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a2954)MetaCyc: 35% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Two-component response regulator"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A159ZT38 at UniProt or InterPro
Protein Sequence (222 amino acids)
>Pf6N2E2_1128 Two-component response regulator (Pseudomonas fluorescens FW300-N2E2) MNPPLRLLLADDHEVTRTGFISMLAGNPGFEVVGQARDGQEALDLCERLQPDIAILDIRM PVLNGLGAARILQQRQPGIKVVIFTMDDSPDHLEAAIGAGAVGYLLKDASRDEVLDALKR VAQGEEALNSSVSARLLRRMAERGANGATQVQALTARERQVLGLVAGGFSNREIGEKLGI APGTAKAHVERVIGKLGAADRTQAAVRGVALGLVAQPSGQWP