Protein Info for Pf6N2E2_1127 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sensory box histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 772 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details PF05227: CHASE3" amino acids 49 to 180 (132 residues), 69.9 bits, see alignment E=7.4e-23 TIGR00229: PAS domain S-box protein" amino acids 267 to 392 (126 residues), 72.2 bits, see alignment E=2.1e-24 PF00989: PAS" amino acids 272 to 383 (112 residues), 33.3 bits, see alignment E=1.6e-11 PF13426: PAS_9" amino acids 284 to 385 (102 residues), 44.9 bits, see alignment E=4.4e-15 PF08448: PAS_4" amino acids 284 to 388 (105 residues), 32.4 bits, see alignment E=3.3e-11 PF00512: HisKA" amino acids 406 to 470 (65 residues), 68.9 bits, see alignment E=1.1e-22 PF02518: HATPase_c" amino acids 518 to 625 (108 residues), 106.6 bits, see alignment E=3.5e-34 PF00072: Response_reg" amino acids 652 to 761 (110 residues), 67.5 bits, see alignment E=4.1e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a2955)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H4P7 at UniProt or InterPro

Protein Sequence (772 amino acids)

>Pf6N2E2_1127 Sensory box histidine kinase/response regulator (Pseudomonas fluorescens FW300-N2E2)
MAMRFLAARRWADLPLRGKALVVISLPLVVLLLSLVLIYITERQTARAEEDVRRVLLVQG
DIQTVHTLLAEAAASVRGYLLTRREDFLPSYEQATPLIHAALQRLDHNIRDARMREHLKT
ITPLIADKLDGLLALRNGKRDDPEAITAILIENKQVLDVLREQISAMRIREDALLADRSA
AASATRMRLLFATLLAAVCGLLGAIVAVLFLSKGIVARVQQVQGNAQRLALGQPLLPQPP
EQDEIGQLGTRLVEAGQLLAERERALRDNEERLRLIIDGVKDYGIFALDAQGYVTTWNAG
AERIKGYTEQEILGRHFSLFYLAEECPAHPDMALREATRDGHYMEEGWRCRKDGSRFWAS
VVITAQYDGTGALRGFSKITRDITDRRAAEIALRTAREEAESASRAKSEFLSRMSHELRT
PLNAILGFAQLLDMDSTAGQRPQVSHILRAGQHLLALINEVLDIARIEAGRLPLNIEPIA
LSTVLHEALTLVSPMAADAGIHLAELPALPDDSGVLADRQRLVQVLLNLLSNAIKYNRPG
GEVRIEVSVQAHQVSIAVNDTGHGIAPEQLDQLFKPFERLGADPQVEGTGLGLSLSKSLL
EMMQGNLQVHSEPGHGCCFTLQLPGTQVVGAHLPPIAALAVTRSPLDYHGKVLCIEDNLS
SLALIETLMQRRPGIQLLSSMQGQMGLDLARQHSPQLILLDVSLPDLEGLEVLRRLRQSA
ATAATPVLMITADASDLTHRALRDAGATAILTKPIHIQAFLGHLEHYLPEPA