Protein Info for Pf6N2E2_1124 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ferric siderophore transport system, periplasmic binding protein TonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details amino acids 44 to 45 (2 residues), see Phobius details transmembrane" amino acids 28 to 43 (16 residues), see Phobius details PF03544: TonB_C" amino acids 193 to 269 (77 residues), 58.5 bits, see alignment E=3.8e-20 TIGR01352: TonB family C-terminal domain" amino acids 194 to 270 (77 residues), 30.4 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a2958)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWS1 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Pf6N2E2_1124 Ferric siderophore transport system, periplasmic binding protein TonB (Pseudomonas fluorescens FW300-N2E2)
MTAMIMHRPSLSVPALGRRFWKNGLAAGLAVALHVGVVALLVLGWSVEKPAAEAPRVLRT
QLVMLPAPPVPEAPALAAVIPVAPPSAEPTSAPVEAPRPVPSQPVVDPRVQAQKLEQAAL
ARKRVEEQKREQQAQQQRERQESERRRQDAEQQVAEQQRQARQAQALAEQRQAEQARQAV
ADSRSYQPLSKQAPDYPQRALDKGLEGDCTVEYSVTPDGRIDNPKVLDGCHPLFIRPSLA
AAQTFRYQPRIIDGKAVTVPAVRNTFHYRIK