Protein Info for Pf6N2E2_1115 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 PF13806: Rieske_2" amino acids 20 to 125 (106 residues), 119.6 bits, see alignment E=2.7e-39 TIGR02378: nitrite reductase [NAD(P)H], small subunit" amino acids 20 to 125 (106 residues), 90.3 bits, see alignment E=3.9e-30

Best Hits

Swiss-Prot: 39% identical to NIRD_ECOLI: Nitrite reductase (NADH) small subunit (nirD) from Escherichia coli (strain K12)

KEGG orthology group: K00363, nitrite reductase (NAD(P)H) small subunit [EC: 1.7.1.4] (inferred from 98% identity to pba:PSEBR_a2965)

MetaCyc: 39% identical to nitrite reductase (NADH) small subunit (Escherichia coli K-12 substr. MG1655)
RXN-13854 [EC: 1.7.1.15]

Predicted SEED Role

"Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.15 or 1.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUF4 at UniProt or InterPro

Protein Sequence (128 amino acids)

>Pf6N2E2_1115 Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4) (Pseudomonas fluorescens FW300-N2E2)
MSQSNVVRIPVRDVAQEPLQWRALCSRDDLVPNSGVVAWHDGSQVALLYLPEHQDKPLYA
IDNRDPKSGANVIGRGLLGSIKGDLVIASPMYKQHFRLEDGHCLEYPEQRLRVWPVRLNG
DVVEIGED