Protein Info for Pf6N2E2_1111 in Pseudomonas fluorescens FW300-N2E2

Annotation: cell wall degradation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 PF20142: Scaffold" amino acids 44 to 168 (125 residues), 71.9 bits, see alignment E=1.4e-23 PF01471: PG_binding_1" amino acids 198 to 253 (56 residues), 34.1 bits, see alignment 3.8e-12 PF03734: YkuD" amino acids 284 to 439 (156 residues), 82 bits, see alignment E=9.9e-27

Best Hits

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a2969)

Predicted SEED Role

"cell wall degradation protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUB5 at UniProt or InterPro

Protein Sequence (508 amino acids)

>Pf6N2E2_1111 cell wall degradation protein (Pseudomonas fluorescens FW300-N2E2)
LLTAPLVATAEDSDPALVQTTLAQLAVACPDVAVGVDFPTQLDLQAFYQQNAGQEVWSDD
ERRGALQVQLQQLADDGLDPARYGLPVEGATQGPHCADIAISRRYLQALHDLRFGYLPQD
RLEPVWKANPPPQDHPAVVLAIAGLGLRNLADAFEQARPNLDLYRNLRGLYARLRQQPLA
EWQAVPGGPLLQPDKQDARVPALAQRLFNEGYLSTPPQLSDEHYSPMLVEAMKSFQAQHS
LQADGVVGPWTVTELNISPAMRREQLRINLERMRWLAQDVEADSVLVNVAAAQLTVYQGG
APVWQTRTQVGRAQRQTPLLKSHVTRLTLNPTWTIPPTIMREDKLPEIRRDPEFLSRHNL
RILDGDGLPLLAEDIDWEHPGNLMLRQDPGPKNPLGKMAIRFPNPFSVYLHDTPSQALFS
KGPRAFSSGCVRIEQVMRLRDLLVSPAERARTETLLASESTHEFRLARPVPILLGYWTAQ
ADSQGQAVYVPDIYGRDATLSAARGRAL