Protein Info for Pf6N2E2_1106 in Pseudomonas fluorescens FW300-N2E2

Annotation: Chromosome initiation inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 263 to 282 (20 residues), see Phobius details PF00126: HTH_1" amino acids 12 to 70 (59 residues), 56.3 bits, see alignment E=2.6e-19 PF03466: LysR_substrate" amino acids 98 to 305 (208 residues), 129.9 bits, see alignment E=8.9e-42

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2973)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZSQ4 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Pf6N2E2_1106 Chromosome initiation inhibitor (Pseudomonas fluorescens FW300-N2E2)
LSRSLFNRLRYKHLHMLVALSASQNLHRASQSLNMSQPAATRMLHEIEDMFGCDLFERLP
RGMRPTALGQELIRFAELALSGLDRCAEDLLARQQGGYGYLSIGTIMGAAPDLVMDSIAR
IKALNPQLRIRIMGDTSDQVIQLLEQGRIDLAIARRNAATDSEHYDFEQLGNERLLVVVH
AGHPLARRKKLALAELVSDWPWILQPETSPARIGLDQALQRLALPMPADIIECSSVYSMQ
QLIQLTDAIMVLSETALRDYLKMGLVVALPVALDVQLAPFGMLRRKGEPVNRELGLFIDL
LRTQAAARR