Protein Info for Pf6N2E2_1099 in Pseudomonas fluorescens FW300-N2E2

Annotation: Hypothetical protein GlcG in glycolate utilization operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF03928: HbpS-like" amino acids 7 to 130 (124 residues), 106.2 bits, see alignment E=6.2e-35

Best Hits

Swiss-Prot: 53% identical to GLCG_ECOL6: Protein GlcG (glcG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11477, glc operon protein GlcG (inferred from 96% identity to pba:PSEBR_a2980)

Predicted SEED Role

"Hypothetical protein GlcG in glycolate utilization operon" in subsystem Glycolate, glyoxylate interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUW3 at UniProt or InterPro

Protein Sequence (141 amino acids)

>Pf6N2E2_1099 Hypothetical protein GlcG in glycolate utilization operon (Pseudomonas fluorescens FW300-N2E2)
MKTKAVLTEQDVAQLLVAVKELAHQRQWAVSVCVVDDGGHPLGLLRLDDASPLSAYIATE
KARTAAMGRRDSKVFEDMINGGRYAFLSAPHLQGMLEGGVCIHHDGQCIGAIGVSGVKAE
QDAELARLAVETALPVITPDS