Protein Info for Pf6N2E2_1098 in Pseudomonas fluorescens FW300-N2E2

Annotation: Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 8 to 253 (246 residues), 260.9 bits, see alignment E=5.8e-82 PF00497: SBP_bac_3" amino acids 29 to 254 (226 residues), 202.9 bits, see alignment E=4.9e-64 PF10613: Lig_chan-Glu_bd" amino acids 50 to 121 (72 residues), 31.5 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 41% identical to ARGT_SALTY: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2981)

Predicted SEED Role

"Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWK1 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Pf6N2E2_1098 Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein (Pseudomonas fluorescens FW300-N2E2)
MNVKRIALKLGLVSLLAFGTSLQAAESSLRIGIEAAYPPFASKTPDNAIVGFDYDIGQAL
CAEMKVRCVWQEQEFDGLIPALKVKKVDAVISSMSITPERLKSVDFTDRYYRIPARLVFR
KGSGINDIPAQLNGKRIGVQRATNFDRYVTDHFAPAGAEVVRYGSQNEIFLDLLGGRLDA
TMASSVVIDESLLKRPEGNDFEFVGPNFTEEQYFGTGIGIAVRKNDTLAGRFNQALATIR
ANGTYERIRQKYFDFDIYGE