Protein Info for Pf6N2E2_1096 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sarcosine oxidase alpha subunit (EC 1.5.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01266: DAO" amino acids 7 to 43 (37 residues), 28.1 bits, see alignment 5.5e-10 PF12831: FAD_oxidored" amino acids 7 to 54 (48 residues), 33.4 bits, see alignment 1.2e-11 PF00890: FAD_binding_2" amino acids 7 to 43 (37 residues), 31.4 bits, see alignment 4.4e-11 PF07992: Pyr_redox_2" amino acids 7 to 318 (312 residues), 75.1 bits, see alignment E=2.4e-24 PF13450: NAD_binding_8" amino acids 10 to 49 (40 residues), 35.8 bits, see alignment 2.8e-12 PF17806: SO_alpha_A3" amino acids 372 to 447 (76 residues), 31.2 bits, see alignment E=7.7e-11

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a2983)

Predicted SEED Role

"Sarcosine oxidase alpha subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZSP3 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Pf6N2E2_1096 Sarcosine oxidase alpha subunit (EC 1.5.3.1) (Pseudomonas fluorescens FW300-N2E2)
MSNAIIDLIIIGAGPAGMSAALEARAHGLSVVVLDEQASPGGQIYRQVLQADARRRAVLG
DDYVAGAKLAADFLQCGARYLPNAAIWQVTPQRQVHYLFEGRAEVLQGRHLLIATGAFER
PMPIPGWTLPGVMTAGAGQILLKSAAMVPATPVVLAGCGPLLYLLAVQYLRAGVALEALV
DTSHRSDLLRAWREVPGALRGWRDLLKGLKLLTELKRAGVRHFRGARNLQVEGTDRACAL
SFDSQGRSQRIRADLILLHQGVVPNTQVSWSLRLEHDWSEQLCWITRRNQWGESSAPGIF
IAGDGGAIGGAQVAQLEGRLAALTIAGQPTRARALQQLLRRARAARPLLDTLYRPRPQNR
IPADDVTVCRCEEVSAGDIRRYVDLGCLGPNQTKAFGRCGMGPCQGRQCGLSVTEIIAER
RHVAPAEVGYYRIRSPLKPITLAQLAGERLSLEEPS