Protein Info for Pf6N2E2_1092 in Pseudomonas fluorescens FW300-N2E2

Annotation: Probable vanillate O-demethylase oxygenase subunit oxidoreductase protein (EC 1.14.13.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF00355: Rieske" amino acids 6 to 86 (81 residues), 75.5 bits, see alignment E=2.5e-25 PF19112: VanA_C" amino acids 140 to 339 (200 residues), 178.8 bits, see alignment E=1.4e-56

Best Hits

Swiss-Prot: 79% identical to VANA_PSEUH: Vanillate O-demethylase oxygenase subunit (vanA) from Pseudomonas sp. (strain HR199 / DSM 7063)

KEGG orthology group: K03862, vanillate monooxygenase [EC: 1.14.13.82] (inferred from 99% identity to pba:PSEBR_a2987)

MetaCyc: 79% identical to vanillate O-demethylase oxygenase component (Pseudomonas sp. HR199)
Vanillate monooxygenase. [EC: 1.14.13.82]

Predicted SEED Role

"Probable vanillate O-demethylase oxygenase subunit oxidoreductase protein (EC 1.14.13.-)" in subsystem Phenylpropanoid compound degradation (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-, 1.14.13.82

Use Curated BLAST to search for 1.14.13.- or 1.14.13.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YYS6 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Pf6N2E2_1092 Probable vanillate O-demethylase oxygenase subunit oxidoreductase protein (EC 1.14.13.-) (Pseudomonas fluorescens FW300-N2E2)
MYPKNAWYVACTPDEIADKPLGRQICGEKMVFYRGHEGKVAAVEDFCPHRGAPLSLGYVE
NGNLVCGYHGLVMGCDGKTVEMPGQRVRGFPCNKTFAVQERHGFIWVWPGDQAQADPALI
HHLEWAESDEWAYGGGLFHIQCDYRLMIDNLMDLTHETYVHASSIGQKEIDEAPPVTTVD
GDEVVTARHMENIMAPPFWRMALRGNNLADDVPVDRWQICRFTPPSHVLIEVGVAHAGNG
GYHAAPQFKASSIVVDFITPETETSIWYFWGMARHFQPQDEALTASIREGQGKIFSEDLE
MLERQQRNLLDHPQRNLLKLNIDAGGVQSRRVLERWIAREREAQAGLIASSHQPQQVEQR
P