Protein Info for Pf6N2E2_1073 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glycogen debranching enzyme (EC 3.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 TIGR02100: glycogen debranching enzyme GlgX" amino acids 21 to 712 (692 residues), 1101.2 bits, see alignment E=0 PF02922: CBM_48" amino acids 25 to 113 (89 residues), 58.4 bits, see alignment E=1.1e-19 PF00128: Alpha-amylase" amino acids 197 to 292 (96 residues), 31.9 bits, see alignment E=1.3e-11 PF21331: Isoamylase_C" amino acids 608 to 711 (104 residues), 61.4 bits, see alignment E=1.7e-20

Best Hits

KEGG orthology group: K02438, glycogen operon protein GlgX [EC: 3.2.1.-] (inferred from 99% identity to pba:PSEBR_a3010)

MetaCyc: 53% identical to isoamylase (Sulfolobus acidocaldarius)
Isoamylase. [EC: 3.2.1.68]

Predicted SEED Role

"Glycogen debranching enzyme (EC 3.2.1.-)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 3.2.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZT01 at UniProt or InterPro

Protein Sequence (719 amino acids)

>Pf6N2E2_1073 Glycogen debranching enzyme (EC 3.2.1.-) (Pseudomonas fluorescens FW300-N2E2)
MTRPKKNTPPPVIEASRIREGLPFPLGATWDGLGVNFALFSANATKVELCIFDDAGEVEL
ERIELPEYTDEIYHGYLPDAHPGLIYGYRVYGPYDPANGHRFNPNKLLIDPYAKQLVGQL
KWSEALFGYTIGHPDGDLSFDERDSAPFVPKCKVIDPAHTWGHDHRVSVPWDKTILYETH
VRGLTMRHPSVPENLRGTFAGLMVDDVLEHIRKLGVSSVELLPIHAFVNDQHLLHKGMTN
YWGYNSIAFFAPDPRYLASGKIAEFKEMVAHLHEANLEVILDVVYNHTAEGNEQGPTLSM
RGIDNASYYRLMPDDKRYYINDSGTGNTLDLSHPCVLQMVTDSLRYWATEMHVDGFRFDL
ATILGRYHDGFDERHSFLVACRQDPVLRQVKMIAEPWDCGPGGYQVGRFPPGWVEWNDKF
RDTVRAFWKGDDGQLADFASRMTASGEMFNQRGRRPYASVNFVTAHDGFTLHDLVSYNDK
HNEANDENNQDGSNNNLSWNHGVEGPTDDPEINALRHRQMRNFFATLLLAQGTPMIVAGD
EFARTQHGNNNAYCQDSEIGWINWDLSEDGATLLKFVKRLIKLRLAYPILRRGRFLVGNY
NEDIGVKDVTWLAPDGSEMTIEQWQDSHGRCLGMLMDGRAQETGIRRKAGDATLLLVVNA
HHDIVNFRLPEVPEGSFWTCMVDTNQPTVRGQERFDFDSEYSVTGRSLLLFELQREEEE