Protein Info for Pf6N2E2_106 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 255 (174 residues), 37.9 bits, see alignment E=7.8e-14

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 99% identity to pba:PSEBR_a3766)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YJB7 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Pf6N2E2_106 Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3) (Pseudomonas fluorescens FW300-N2E2)
MSKRKLIPLLIYILFLLVPIYWLLNMSFKSNTEILGSLTLWPQDFTFHNYKVIFTDPSWY
TGYLNSLYYVSLNTVISLGVALPAAYAFSRYRFLGDKHLFFWLLTNRMAPPAVFLLPFFQ
LYSSIGLFDTHIAVALAHCLFNVPLAVWILEGFMSGVPKEIDETAYIDGYSFPKFFAKIF
IPLIGSGIGVTAFFCFMFSWVELLLARTLTSVNAKPIAAVMTRTVSASGIDWGVLAAAGV
LTILPGMLVIWFVRNHVAKGFALGRV