Protein Info for Pf6N2E2_1038 in Pseudomonas fluorescens FW300-N2E2

Annotation: citrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 56 to 80 (25 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details amino acids 280 to 304 (25 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 343 to 360 (18 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details TIGR00784: citrate transporter" amino acids 1 to 426 (426 residues), 500.7 bits, see alignment E=2.3e-154 PF03600: CitMHS" amino acids 13 to 372 (360 residues), 95.9 bits, see alignment E=1.3e-31

Best Hits

Predicted SEED Role

"citrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YYD9 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Pf6N2E2_1038 citrate transporter (Pseudomonas fluorescens FW300-N2E2)
MLIFLSYAMIASFMYLIMSKRLSPLVALLLVPIVFGCLSGFTTQLGGMMYDGIKMLAPTG
IMLTFAILYFCMMTDAGLFNPLIKVLLRLVKGDPRKIVIGTAVLGLCVGLDGDGATTYII
ATAAFLPIYRLTGIRLQVMATVLLMAIGVMNILPWAGPFSRAASAMHVDITELFLEMVPV
MIAGGVWVIFAAWWLGRMEYRRLGLIAVSEDEVLKGYAHIRLSDPKFLLNVVLTVALISC
MMLNLMPLPILFMVAFGLACLVNFPTLKQQKEVIARHADNVMAVTLLIFAAGIFVGIMGG
TGMIKAISDNLITLLPQQAGHYMSVITALLSMPFTYVLTNDAFYFGVLPILAETAAHYGI
GPNEMAIASLIGQPVHLLSPLVASTYLLCGLLDIDYGDNQRVSLKWTFGTVIVMLFAAIA
IGAITVVN