Protein Info for Pf6N2E2_1022 in Pseudomonas fluorescens FW300-N2E2

Annotation: Butyryl-CoA dehydrogenase (EC 1.3.99.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF02771: Acyl-CoA_dh_N" amino acids 20 to 95 (76 residues), 35.1 bits, see alignment E=3.1e-12 PF02770: Acyl-CoA_dh_M" amino acids 134 to 224 (91 residues), 48.5 bits, see alignment E=1.6e-16 PF00441: Acyl-CoA_dh_1" amino acids 247 to 369 (123 residues), 34.6 bits, see alignment E=4.1e-12 PF08028: Acyl-CoA_dh_2" amino acids 256 to 371 (116 residues), 40.9 bits, see alignment E=4.9e-14

Best Hits

KEGG orthology group: None (inferred from 81% identity to pfs:PFLU3692)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YY97 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Pf6N2E2_1022 Butyryl-CoA dehydrogenase (EC 1.3.99.2) (Pseudomonas fluorescens FW300-N2E2)
MSLSSLRPPLLQSVDVADFDTVLEHLSQQLGATAHIYDESGEFPLENFKLLHEHGLLALT
VPKALGGGGASLAQARKVIAAVAKGEPSTALILVMQYLQHSRLQDSRSWPEALRLRVAQD
AVRDGALINALRVEPDLGTPARGGLPATVARRTSKGWRISGRKIYSTGSHGLTWFSVWAR
STDEDPLVGAWLVHRDTPGISIIEDWDHLGMRATCSHEVLFDNVLVPLDHAVSVSPWSAP
QPELDSEGFLWMAVLLAAVYDGVAQAARDWFVGWLEQRKPSNLGAALATLPRFQETVGHL
DTLLFANRSLLDAAAEGLTLAQHAAQLKYLVTGNAIRAVELTIEASGNPGLSRHNPLQRH
YRDVLCSRVHTPQNDAVLQGVGKAVFAQRQKKDIS