Protein Info for Pf6N2E2_1015 in Pseudomonas fluorescens FW300-N2E2

Annotation: Inositol transport system sugar-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 24 to 283 (260 residues), 193.7 bits, see alignment E=6.4e-61 PF00532: Peripla_BP_1" amino acids 30 to 238 (209 residues), 56.1 bits, see alignment E=6.4e-19 PF13458: Peripla_BP_6" amino acids 53 to 257 (205 residues), 32 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 45% identical to MOCB_RHIML: Putative rhizopine-binding protein (mocB) from Rhizobium meliloti

KEGG orthology group: None (inferred from 72% identity to avn:Avin_26220)

Predicted SEED Role

"Inositol transport system sugar-binding protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWD6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Pf6N2E2_1015 Inositol transport system sugar-binding protein (Pseudomonas fluorescens FW300-N2E2)
MKKRLLTYLFVALFAPLALADIRIGVSIAQVDDVFLAQMRDYMAAHAKDLPGVNLQFEDA
QGDVVRQLNQVQNFTAQGMDAIIVNPVDTAATQKMTAHAQKASVPLVYVNRRPDQAELPP
GVGYVGSDEIKAGEMQMRYLAEKMGGKGNLAIMLGLLSNNATHNRTQGVKEVLKSYPDIH
VVEEQSAEWQRSKAMDLMNNWILSGKKIDAVAANADEMAIGAAMAINQAGMRSGKDILVG
GSDGGPAGLDAIKKDQLLVTVYQDNKGQAIGSIDLALKMIRKEPFAAELTIPYQLITKAN
YQDFLNP