Protein Info for Pf1N1B4_973 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01433: ubiquinol oxidase, subunit II
  • amino acids 4 to 225 (222 residues), 381.8 bits, E=4.6e-119
• PF00116: COX2
  • amino acids 134 to 203 (70 residues), 24.1 bits, E=2.9e-09
• PF06481: COX_ARM
  • amino acids 225 to 268 (44 residues), 58.2 bits, 5.8e-20

Best Hits

Swiss-Prot: 74% identical to CYOA_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Pseudomonas putida

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 90% identity to pfo:Pfl01_4648)

MetaCyc: 76% identical to cytochrome bo terminal oxidase subunit II (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See A0A166MY15 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Pf1N1B4_973 Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-) (Pseudomonas fluorescens FW300-N1B4)
LPLLGTLLLGGCNMTLLDPKGQVGLDERNLIITATLLMLLVVVPVIFMTFAFAWKYRASN
KDAVYTPKWSHSTKIEIAVWTIPVLIIIALGYVTYKSTHALDPYKPLESDVKPITIEVVA
LDWKWLFIYPEQGIATVNKIVFPAHTPINFKITSDAVMNSFFIPALGGQIYAMAGMQTKL
HLIANQNAEMDGISANYSGAGFTGMKFKAIATSQEDFDAWVSEVKKAPKQLEQAEYAALA
KQSQNNPVELYSSVTPNLFQIIVDKYEGMKPGPKVKHEKKEKEVAATQGMDMNSHSAAGA
EE