Protein Info for Pf1N1B4_957 in Pseudomonas fluorescens FW300-N1B4

Annotation: 21 kDa hemolysin precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF04972: BON" amino acids 46 to 115 (70 residues), 49.8 bits, see alignment E=1.8e-17 amino acids 125 to 190 (66 residues), 57.3 bits, see alignment E=7.7e-20

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a4634)

Predicted SEED Role

"21 kDa hemolysin precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MXQ2 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Pf1N1B4_957 21 kDa hemolysin precursor (Pseudomonas fluorescens FW300-N1B4)
MTPNRLGLLALTLCLGISGCTSVVNASREAPIDDDRGTRTFGSKIDDSLIETKAGVNIAK
ADPDLDNNSHIVVTSFNGVVLLAGQTPRADLKAKAEQVAASVQRVKKVHNELQVLQPSSL
LARQNDTWLTTKIKTQMLTDASIPGSRIKVVTENGIVYLLGLLTKQEAAQATNLVQGVSG
VQKIVKLFEYID