Protein Info for Pf1N1B4_941 in Pseudomonas fluorescens FW300-N1B4

Annotation: D-alanine--D-alanine ligase (EC 6.3.2.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 19 to 311 (293 residues), 353.6 bits, E=4.2e-110
• PF01820: Dala_Dala_lig_N
  • amino acids 67 to 101 (35 residues), 43.4 bits, 1.7e-14
• PF02655: ATP-grasp_3
  • amino acids 110 to 281 (172 residues), 25.2 bits, E=5.5e-09
• PF02786: CPSase_L_D2
  • amino acids 111 to 302 (192 residues), 47.6 bits, E=5.4e-16
• PF07478: Dala_Dala_lig_C
  • amino acids 119 to 310 (192 residues), 189.8 bits, E=1.5e-59
• PF02222: ATP-grasp
  • amino acids 121 to 280 (160 residues), 33.5 bits, E=1.1e-11
• PF13535: ATP-grasp_4
  • amino acids 146 to 281 (136 residues), 35.7 bits, E=2.4e-12

Best Hits

Swiss-Prot: 91% identical to DDL_PSEPF: D-alanine--D-alanine ligase (ddl) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 91% identity to pfo:Pfl01_4671)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

See A0A166MXE7 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Pf1N1B4_941 D-alanine--D-alanine ligase (EC 6.3.2.4) (Pseudomonas fluorescens FW300-N1B4)
MTAAYANLVSTLLPKDFGRVAVLFGGKSAEREVSLKSGNAVLDALQSAGVDAFGLDVGDD
LLQRLLNEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLSSEADCISAATELGFPLIVKPAHEGSSIGMAKVTSASELIDAWKAAST
YDSQVLVEQWIQGPEFTIATLRDQVLPPIALGTTHSFYDYDAKYVASDTQYRIPCGLDSN
KEKELMDLTAKACEALGIAGWGRADVMQDADGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASVTGNAAGNQEPTRG