Protein Info for Pf1N1B4_920 in Pseudomonas fluorescens FW300-N1B4

Annotation: ATP-dependent RNA helicase RhlB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF00270: DEAD" amino acids 78 to 253 (176 residues), 159.7 bits, see alignment E=8.7e-51 PF04851: ResIII" amino acids 98 to 248 (151 residues), 33.9 bits, see alignment E=4.6e-12 PF00271: Helicase_C" amino acids 289 to 397 (109 residues), 102.7 bits, see alignment E=2.1e-33

Best Hits

Swiss-Prot: 95% identical to RHLB_PSESM: ATP-dependent RNA helicase RhlB (rhlB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03732, ATP-dependent RNA helicase RhlB [EC: 3.6.4.13] (inferred from 94% identity to pfo:Pfl01_0971)

MetaCyc: 46% identical to ATP-dependent RNA helicase RhlB (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase RhlB" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13 or 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MX49 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Pf1N1B4_920 ATP-dependent RNA helicase RhlB (Pseudomonas fluorescens FW300-N1B4)
VITPTAPAAEPIASEQPRSEAPKPAKPRREPKPKAPVIPWKLEDFVVEPQEGKTRFHDFK
LAPELMHAIQDLGFPYCTPIQAQVLGFTLAGKDAIGRAQTGTGKTAAFLISIITQLLQTP
PPKERYMGEPRALIIAPTRELVVQIAKDAADLTKYTGLNVMTFVGGMDFDKQLKHLEARH
CDILVATPGRLLDFNQRGDVHLDMVEVMVLDEADRMLDMGFIPQVRQIIRQTPPKNERQT
LLFSATFTEDVMNLAKQWTTDPSIVEIEAQNVASENVEQHIYAVAGADKYKLLYNLVNDN
GWERVMVFANRKDEVRRIEERLVRDGVNAAQLSGDVPQHKRIKTLEGFREGKIRVLVATD
VAGRGIHIDGISHVINFTLPEVPDDYVHRIGRTGRAGADGVSISFAGEDDSYQLPSIEAL
LGRKISCETPPTHLLRAVERKRP