Protein Info for Pf1N1B4_9 in Pseudomonas fluorescens FW300-N1B4

Annotation: Probable type IV pilus assembly FimV-related transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 877 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 414 to 434 (21 residues), see Phobius details amino acids 597 to 615 (19 residues), see Phobius details TIGR03505: FimV N-terminal domain" amino acids 170 to 241 (72 residues), 87.7 bits, see alignment E=3.4e-29 PF14559: TPR_19" amino acids 534 to 596 (63 residues), 25.3 bits, see alignment 1.5e-09 TIGR03504: FimV C-terminal domain" amino acids 833 to 876 (44 residues), 72.5 bits, see alignment 2.2e-24

Best Hits

KEGG orthology group: K07288, uncharacterized membrane protein (inferred from 78% identity to pfo:Pfl01_1895)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MD81 at UniProt or InterPro

Protein Sequence (877 amino acids)

>Pf1N1B4_9 Probable type IV pilus assembly FimV-related transmembrane protein (Pseudomonas fluorescens FW300-N1B4)
MVQVRKLVLAIAAASALSSGMAHALGLGELTLKSTLNQPLVAEIELLDVKDLTAAEVVPS
LASPEDFAKAGVDRQAFLNDLTFTPVLNASGKSILRVTSSKPLSEPMVKFLVQVMWPNGR
LLRDYSVLLDPSKFSPQTADAAAQPAPAQTVTAPVTGATKSSQYTTTPRDTLWEIAAKAR
NGGSIQQTMLAIQALNPDAFIDGNINRLKTGQVLRLPDQVQSTNLSQPKAIAEVAAQNTA
WRQGRRYVAKPGTGQQQLDATKRARGEGASSQPAADKLSLVSADTGKGGKGAAGDAKALS
DKLAVTEESLDATRRDNAELKSRMSDLQSQLDKLQRLIELKNNQLAKLQAEGGADASASS
APAMSAELAANTAATPADASATTSAPQAAAPEAVEPAPATSENQKFNELLTNPILLGLVG
GGAVVLLLLLLLLARRRKAQQEAEKHLRMARALEEEQEFSVDQDLPPSSFEGLEVPPPSV
KLATAPTPAPAPAPVIAPVVVTPPIAAPLVSPAAERSDRSDDVLAQAQSHITGGRLNQAA
ALLEDAIKQAPQRSDLRLKLMEVYGQQGDRDAFVAQERQLVANGDNFARVEELKSRFPAM
AVVAASGLAAAAIAAELDAQYVKDLLLDEPQAPEPSLSDFDSAFDLSLDDLEAATPISPA
IALVPEPTPEPTPAPEALAELDEFPLDDDLSFESVLQQQTEIKENLDDLSDFDLDMDLGG
DASPATLAEDDFLLSLDEDLKDLPVAEAAPVTEPTLDDLELPADFDLSLADEMDAAAPDQ
PDAFESELNDVNAELDRLSQSLGEPSFTAEDALASAADEPDFDFLSGTDEVATKLDLAQA
YIDMGDSDGARDILNEVVTEGDAGQKSEAREMLSRLA