Protein Info for Pf1N1B4_875 in Pseudomonas fluorescens FW300-N1B4

Annotation: Glutamate synthase [NADPH] small chain (EC 1.4.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 125 to 151 (27 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 40 to 264 (225 residues), 135.6 bits, see alignment E=9.6e-44

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_1017)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MVX7 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Pf1N1B4_875 Glutamate synthase [NADPH] small chain (EC 1.4.1.13) (Pseudomonas fluorescens FW300-N1B4)
LSPSLLTTLAAACLYAAATLYQGTRLATGAKANKRLLVTLGVLAVLAHSVSLITYLLTPI
GLALDFFSAASLIAAAVIALTLLACSRIPVENLLLLLFPLGAATVVLAQFAPAGTVQIID
EAPGILAHILLSILAYGMFTIAVFQSLLLLVQDHQLKHKHPSGLIKNFPPLQTMESLLFG
FLWAGWSLLSLSLISGWLFVENLFAQHLVHKTLLACLAWIVFSVLLWGRNRLGWRGHKAI
RWTLAGFCLLMLAYFGSKLVREYILHI