Protein Info for Pf1N1B4_862 in Pseudomonas fluorescens FW300-N1B4

Annotation: Chaperone protein HscB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR00714: Fe-S protein assembly co-chaperone HscB" amino acids 16 to 171 (156 residues), 106.6 bits, see alignment E=6.7e-35 PF00226: DnaJ" amino acids 19 to 73 (55 residues), 31.8 bits, see alignment E=1.2e-11 PF07743: HSCB_C" amino acids 90 to 164 (75 residues), 57.7 bits, see alignment E=1.3e-19

Best Hits

Swiss-Prot: 90% identical to HSCB_PSEFS: Co-chaperone protein HscB homolog (hscB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K04082, molecular chaperone HscB (inferred from 94% identity to pfl:PFL_4962)

MetaCyc: 40% identical to [Fe-S] cluster biosynthesis co-chaperone HscB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Chaperone protein HscB" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4V7R0 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Pf1N1B4_862 Chaperone protein HscB (Pseudomonas fluorescens FW300-N1B4)
VGTPCHFALFELKPSFRLDLDQLATRYRELARGVHPDRFADASEREQRLALEQSASLNEA
YQTLKSPPKRARYLLAMGGRELPLEVTVHDPEFLLQQMELREELEDLQDSADLAGVAVFK
RRLKTAQDELNESFAACWDDAAQREQAERLMRRMQFLDKLTYEVRQLEERLDD